missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18361749

ZNF266 Antibody (1B9), Novus Biologicals™

Product Code. 18361749 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18361749 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18361749 Supplier Novus Biologicals Supplier No. H00010781M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ZNF266 Monoclonal antibody specifically detects ZNF266 in Human samples. It is validated for Western Blot, ELISA, Immunoprecipitation, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZNF266
Applications Western Blot, ELISA, Immunoprecipitation, Sandwich ELISA
Classification Monoclonal
Clone 1B9
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006622
Gene Alias KOX5BRC1744, Zinc finger protein 13Zinc finger protein KOX5, zinc finger protein 45, zinc finger protein 45 (a Kruppel-associated box (KRAB) domain polypeptide), ZNF13
Host Species Mouse
Immunogen ZNF266 (NP_006622.2, 274 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIH
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10781
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.