missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF264 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF264 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
ZNF264 Polyclonal specifically detects ZNF264 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZNF264 | |
| Unconjugated | |
| RUO | |
| KIAA0412, zinc finger protein 264 | |
| ZNF264 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_003408 | |
| 9422 | |
| Synthetic peptide directed towards the C terminal of human ZNF264. Peptide sequence SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title