missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF257 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF257 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF257 Polyclonal specifically detects ZNF257 in Human samples. It is validated for Western Blot.Specifications
| ZNF257 | |
| Polyclonal | |
| Rabbit | |
| MGC32104, zinc finger protein 480 | |
| ZNF257 | |
| IgG | |
| 66 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 113835 | |
| Synthetic peptides corresponding to ZNF257 (zinc finger protein 257) The peptide sequence was selected from the C terminal of ZNF257. Peptide sequence HLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGENPNKYEECGK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title