missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF256 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF256 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF256 Polyclonal specifically detects ZNF256 in Human samples. It is validated for Western Blot.Specifications
| ZNF256 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| zinc finger protein 483, zinc finger protein HIT-10, Zinc finger protein with KRAB and SCAN domains 16, ZKSCAN16KIAA1962 | |
| ZNF256 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_005764 | |
| 10172 | |
| Synthetic peptide directed towards the N terminal of human ZNF256The immunogen for this antibody is ZNF256. Peptide sequence LYHDVMLENLTLTTSLGGSGAGDEEAPYQQSTSPQRVSQVRIPKALPSPQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title