missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF19 Polyclonal specifically detects ZNF19 in Human samples. It is validated for Western Blot.Specifications
| ZNF19 | |
| Polyclonal | |
| Rabbit | |
| P17023 | |
| 7567 | |
| Synthetic peptides corresponding to ZNF19(zinc finger protein 19) The peptide sequence was selected from the N terminal of ZNF19. Peptide sequence TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KOX12MGC51021, zinc finger protein 19, zinc finger protein 19 (KOX 12), Zinc finger protein KOX12 | |
| ZNF19 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title