ZNF182 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18463282	Novus Biologicals NBP2-32480-25ul	25 μL
18106184	Novus Biologicals NBP2-32480	0.1 mL

Description

ZNF182 Polyclonal specifically detects ZNF182 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNF182
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 7569
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: HHZ150, KOX14zinc finger protein 182 (HHZ150), MGC131713, Zfp182, zinc finger protein 182, Zinc finger protein 21, zinc finger protein 21 (KOX 14), Zinc finger protein KOX14, ZNF21MGC125383
• Gene Symbols: ZNF182
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only