ZNF18 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09244-100UL

Product Code. 18374125

Description

ZNF18 Polyclonal specifically detects ZNF18 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF18
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: HDSG1Zinc finger protein 535, heart development-specific protein, KOX11Heart development-specific gene 1 protein, Zfp535, zinc finger protein 18, zinc finger protein 18 (KOX 11), ZKSCAN6Zinc finger protein KOX11, ZNF535Zinc finger protein with KRAB and SCAN domains 6
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ZNF18 (NP_080383). Peptide sequence FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7566
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.