missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ZNF18 Monoclonal antibody specifically detects ZNF18 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
Specifications
| Antigen | ZNF18 |
| Applications | Western Blot, ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2A4 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_653281 |
| Gene Alias | HDSG1Zinc finger protein 535, heart development-specific protein, KOX11Heart development-specific gene 1 protein, Zfp535, zinc finger protein 18, zinc finger protein 18 (KOX 11), ZKSCAN6Zinc finger protein KOX11, ZNF535Zinc finger protein with KRAB and SCAN domains 6 |
| Host Species | Mouse |
| Immunogen | ZNF18 (NP_653281, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?