missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF17 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF17 Polyclonal specifically detects ZNF17 in Human samples. It is validated for Western Blot.Specifications
| ZNF17 | |
| Polyclonal | |
| Rabbit | |
| NP_008890 | |
| 7565 | |
| Synthetic peptide directed towards the N terminal of human ZNF17. Peptide sequence TEDYMVFEDVAIHFSQEEWGILNDVQRHLHSDVMLENFALLSSVGCWHGA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10, zinc finger protein 17, zinc finger protein 17 (HPF3, KOX 10), zinc finger protein HPF3, zinc finger protein KOX10 | |
| ZNF17 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title