missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF157 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £366.00
Specifications
| Antigen | ZNF157 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666981
|
Novus Biologicals
NBP2-93260-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663790
|
Novus Biologicals
NBP2-93260-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF157 Polyclonal antibody specifically detects ZNF157 in Human samples. It is validated for Western BlotSpecifications
| ZNF157 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| HZF22, zinc finger protein 157, zinc finger protein 157 (HZF22), zinc finger protein 22, Zinc finger protein HZF22 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 70-165 of human ZNF157 (NP_003437.2). VAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 7712 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title