missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF141 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09216-100UL
This item is not returnable.
View return policy
Description
ZNF141 Polyclonal specifically detects ZNF141 in Human samples. It is validated for Western Blot.
Specifications
| ZNF141 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| D4S90, pHZ-44, zinc finger protein 141 | |
| The immunogen is a synthetic peptide directed towards the middle region of human ZNF141 (NP_003432). Peptide sequence KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7700 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion