missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Especificaciones
| Antigen | ZNF12 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Descripción
ZNF12 Polyclonal specifically detects ZNF12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| ZNF12 | |
| Polyclonal | |
| Purified | |
| RUO | |
| GIOT3, Gonadotropin-inducible ovary transcription repressor 3, HZF11, zinc finger protein 11, zinc finger protein 12, Zinc finger protein 325GIOT-3KOX3gonadotropin inducible transcription repressor 3, Zinc finger protein KOX3, ZNF325 | |
| ZNF12 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 7559 | |
| Synthetic peptide directed towards the N terminal of human ZNF12. Peptide sequence: FLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFD | |
| Primary | |
| 58 kDa |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto