missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF101 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF101 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF101 Polyclonal specifically detects ZNF101 in Human samples. It is validated for Western Blot.Specifications
| ZNF101 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp570I0164, HZF12, MGC149565, MGC149566, zinc finger protein 101, zinc finger protein 101 (Y2), zinc finger protein 12, Zinc finger protein HZF12 | |
| ZNF101 | |
| IgG | |
| 50 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IZC7 | |
| 94039 | |
| Synthetic peptides corresponding to ZNF101 (zinc finger protein 101) The peptide sequence was selected from the N terminal of ZNF101. Peptide sequence EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title