missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNDR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69057-25ul
This item is not returnable.
View return policy
Description
ZNDR1 Polyclonal antibody specifically detects ZNDR1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ZNDR1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| DNA-directed RNA polymerase I subunit RPA12, HTEX-6, hZR14, MGC13376, RNA polymerase I small specific subunit Rpa12, Rpa12, tctex-6, TEX6, transcription-associated zinc ribbon protein, zinc ribbon domain containing 1, zinc ribbon domain containing, 1, Zinc ribbon domain-containing protein 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS | |
| 25 μL | |
| DNA replication Transcription Translation and Splicing | |
| 30834 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction