ZMYM4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58244-25ul

Product Code. 18646147

Description

ZMYM4 Polyclonal specifically detects ZMYM4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ZMYM4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CDIR, cell death inhibiting RNA, KIAA0425DKFZp686L0547, MYM, zinc finger MYM-type protein 4, Zinc finger protein 262DKFZp686B09210, zinc finger, MYM-type 4, ZNF198L3, ZNF262
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9202
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZMYM4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVRENSKETFSGKEKNRDLTYEREKRLDKPHKDLDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSELG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only