missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZMIZ1/Zimp10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ZMIZ1/Zimp10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18398262 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18398262 100 μg 100µL
18313836 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18398262 Supplier Novus Biologicals Supplier No. NBP317966100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ZMIZ1/Zimp10 Polyclonal antibody specifically detects ZMIZ1/Zimp10 in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZMIZ1/Zimp10
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias FLJ13541, hZIMP10, KIAA1224Zimp10, MIZ, PIAS-like protein Zimp10, RAI17TRAFIP10, retinoic acid induced 17, Retinoic acid-induced protein 17, RP11-519K18.1, ZIMP10FLJ00092 protein, zinc finger MIZ domain-containing protein 1, zinc finger, MIZ-type containing 1, zinc finger-containing, Miz1, PIAS-like protein on chromosome 10
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 57178
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.