missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Zinc finger protein 639 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49035-25ul
This item is not returnable.
View return policy
Description
Zinc finger protein 639 Polyclonal antibody specifically detects Zinc finger protein 639 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Zinc finger protein 639 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ANC_2H01, ZASC1ANC-2H01, zinc finger amplified in esophageal squamous cell carcinomas 1, zinc finger protein 639, Zinc finger protein ANC_2H01, Zinc finger protein ZASC1,6230400O18Rik | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVL | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 51193 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction