missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Zinc finger protein 395 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Zinc finger protein 395 Polyclonal specifically detects Zinc finger protein 395 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Zinc finger protein 395 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | dJ874C20.2, FLJ23407, zinc finger protein 310 pseudogene, zinc finger protein 323, ZNF20-Lp, ZNF310P |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human Zinc finger protein 395 (NP_061130). Peptide sequence SGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?