missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZGPAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZGPAT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZGPAT Polyclonal specifically detects ZGPAT in Human samples. It is validated for Western Blot.Specifications
| ZGPAT | |
| Polyclonal | |
| Rabbit | |
| Q8N5A5 | |
| 84619 | |
| Synthetic peptides corresponding to ZGPAT(zinc finger, CCCH-type with G patch domain) The peptide sequence was selected from the C terminal of ZGPAT. Peptide sequence AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| GPATC6G patch domain-containing protein 6, GPATCH6Zinc finger and G patch domain-containing protein, KIAA1847Zinc finger CCCH domain-containing protein 9, MGC44880, ZC3H9FLJ14972, ZC3HDC9dJ583P15.3, zinc finger, CCCH-type with G patch domain, ZIPzinc finger CCCH-type with G patch domain-containing protein | |
| ZGPAT | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title