ZFYVE26 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18466781	Novus Biologicals NBP2-31606-25ul	25 μL
18129983	Novus Biologicals NBP2-31606	0.1 mL

Description

ZFYVE26 Polyclonal specifically detects ZFYVE26 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZFYVE26
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp686F19106, DKFZp781H1112, FYVE domain-containing centrosomal protein, FYVE-CENT, KIAA0321zinc finger FYVE domain-containing protein 26, spastic paraplegia 15 (complicated, autosomal recessive), Spastizin, SPG15, zinc finger, FYVE domain containing 26
• Gene Symbols: ZFYVE26
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q68DK2
• Gene ID (Entrez): 23503
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only