missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZFP14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZFP14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZFP14 Polyclonal specifically detects ZFP14 in Human samples. It is validated for Western Blot.Specifications
| ZFP14 | |
| Polyclonal | |
| Rabbit | |
| NP_065968 | |
| 57677 | |
| Synthetic peptide directed towards the N terminal of human ZFP14The immunogen for this antibody is ZFP14. Peptide sequence KSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1559, zfp-14, zinc finger protein 14 homolog, zinc finger protein 14 homolog (mouse), zinc finger protein 531, ZNF531 | |
| ZFP14 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title