missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZFAND3 Antibody (2D2), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00060685-M03
This item is not returnable.
View return policy
Description
ZFAND3 Monoclonal antibody specifically detects ZFAND3 in Human samples. It is validated for Western Blot, ELISA
Specifications
| ZFAND3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| AN1-type zinc finger protein 3, FLJ17799, testis expressed sequence 27, Testis-expressed sequence 27, TEX27FLJ13222, zinc finger, AN1-type domain 3 | |
| ZFAND3 (NP_068762.1, 2 a.a. ∽ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF | |
| 0.1 mg | |
| Signal Transduction | |
| 60685 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA | |
| 2D2 | |
| Western Blot 1:500, ELISA | |
| NP_068762 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction