missing translation for 'onlineSavingsMsg'
Learn More

ZDHHC8 Antibody (1C5), Novus Biologicals™

Product Code. 18393509 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18393509 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18393509 Supplier Novus Biologicals Supplier No. H00029801M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ZDHHC8 Monoclonal antibody specifically detects ZDHHC8 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZDHHC8
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1C5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH09442
Gene Alias DHHC8, EC 2.3.1, EC 2.3.1.-, KIAA1292DHHC-8, membrane-associated DHHC8 zinc finger protein, probable palmitoyltransferase ZDHHC8, ZDHHCL1, Zinc finger DHHC domain-containing protein 8, Zinc finger protein 378, zinc finger, DHHC-type containing 8, ZNF378zinc finger, DHHC domain like containing 1
Host Species Mouse
Immunogen ZDHHC8 (AAH09442, 1 a.a. ~ 42 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 29801
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.