missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | ZDHHC21 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18262653
|
Novus Biologicals
NBP2-57201 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675577
|
Novus Biologicals
NBP2-57201-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZDHHC21 Polyclonal specifically detects ZDHHC21 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ZDHHC21 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 340481 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Polyclonal | |
| Rabbit | |
| Human | |
| DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik | |
| ZDHHC21 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title