ZDHHC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13540

Product Code. 18011089

Description

ZDHHC1 Polyclonal specifically detects ZDHHC1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZDHHC1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C16orf1, DHHC domain-containing cysteine-rich protein 1, DHHC-1, DHHC-domain-containing cysteine-rich protein, EC 2.3.1.-, HSU90653, probable palmitoyltransferase ZDHHC1, Zinc finger DHHC domain-containing protein 1, Zinc finger protein 377, zinc finger, DHHC domain containing 1, zinc finger, DHHC-type containing 1, ZNF377chromosome 16 open reading frame 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29800
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZDHHC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHCS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only