ZBTB6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49116-25ul

Product Code. 18699168

Description

ZBTB6 Polyclonal antibody specifically detects ZBTB6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ZBTB6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: zinc finger and BTB domain containing 6, zinc finger and BTB domain-containing protein 6, Zinc finger protein 482ZIDZinc finger protein with interaction domain, ZNF482
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CTEPLSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVK
• Quantity: 25 μL
• Research Discipline: Cancer, Cell Cycle and Replication
• Gene ID (Entrez): 10773
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified