ZBTB38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80263

Product Code. 18260706

Description

ZBTB38 Polyclonal specifically detects ZBTB38 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ZBTB38
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CIBZ, FLJ22332, FLJ31131, FLJ35036, zinc finger and BTB domain containing 38, zinc finger and BTB domain-containing protein 38, ZNF921
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 253461
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_780746
• Gene Symbols: ZBTB38
• Immunogen: Synthetic peptide directed towards the N terminal of human ZBTB38. Peptide sequence EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Bovine: 92%; Equine: 92%; Human: 92%; Pig: 92%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG