missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZBTB26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZBTB26 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZBTB26 Polyclonal specifically detects ZBTB26 in Human samples. It is validated for Western Blot.Specifications
| ZBTB26 | |
| Polyclonal | |
| Rabbit | |
| NP_065975 | |
| 57684 | |
| Synthetic peptide directed towards the middle region of human ZBTB26. Peptide sequence QIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1572, zinc finger and BTB domain containing 26, zinc finger and BTB domain-containing protein 26, Zinc finger protein 481bioref, zinc finger protein 483, Zinc finger protein Bioref, ZNF481 | |
| ZBTB26 | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title