missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18346939

Novus Biologicals™ ZBTB20 Antibody (1F3), Novus Biologicals™

Product Code. 18346939 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346939 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346939 Supplier Novus Biologicals™ Supplier No. H00026137M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ZBTB20 Monoclonal antibody specifically detects ZBTB20 in Human samples. It is validated for ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZBTB20
Applications ELISA, Western Blot, Sandwich ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 1F3
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_056457
Gene Alias BTB/POZ zinc finger protein DPZF, dendritic cell-derived BTB/POZ zinc finger, Dendritic-derived BTB/POZ zinc finger protein, DPZFZinc finger protein 288ZNF288DKFZp566F123, FLJ26458, HOF, ODA-8S, zinc finger and BTB domain containing 20, zinc finger and BTB domain-containing protein 20
Host Species Mouse
Immunogen ZBTB20 (NP_056457, 451 a.a. ∽ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26137
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.