missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZBTB12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZBTB12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZBTB12 Polyclonal specifically detects ZBTB12 in Human samples. It is validated for Western Blot.Specifications
| ZBTB12 | |
| Polyclonal | |
| Rabbit | |
| NP_862825 | |
| 221527 | |
| Synthetic peptide directed towards the N terminal of human ZBTB12. Peptide sequence MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf46, chromosome 6 open reading frame 46, D6S59E, G10Bat9, NG35HLA-B-associated transcript 9, Protein G10, zinc finger and BTB domain containing 12, zinc finger and BTB domain-containing protein 12 | |
| ZBTB12 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title