missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZACN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZACN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZACN Polyclonal specifically detects ZACN in Human samples. It is validated for Western Blot.Specifications
| ZACN | |
| Polyclonal | |
| Rabbit | |
| NP_851321 | |
| 353174 | |
| Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| L2, LGICZ1, ligand-gated ion channel subunit, ligand-gated ion channel, zinc activated 1, ligand-gated ion-channel receptor L2, MGC129841, ZAC, ZAC1, zinc activated ligand-gated ion channel, zinc activated ligand-gated ion channel 1, zinc-activated ligand-gated ion channel | |
| ZACN | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title