missing translation for 'onlineSavingsMsg'
Learn More

YOD1 Antibody, Novus Biologicals™

Product Code. 30231164 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30231164 20 μL 20µL
30232368 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30231164 Supplier Novus Biologicals Supplier No. NBP33339320ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

YOD1 Monoclonal antibody specifically detects YOD1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen YOD1
Applications ELISA, Western Blot
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias DKFZp451J1719, DUBA-8, DUBA8hsHIN7, EC 3.1.2, EC 3.4.19.12, HIN7, HIN-7, HIV-1-induced protease 7, HsHIN7, OTU domain-containing protein 2, OTUD2OTU domain containing 2, PRO0907, ubiquitin thioesterase OTU1, YOD1 OTU deubiquinating enzyme 1 homolog ( yeast), YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 249-348 of human YOD1.3).,, Sequence:, FGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 55432
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.