missing translation for 'onlineSavingsMsg'
Learn More
Learn More
YOD1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33393-20ul
This item is not returnable.
View return policy
Description
YOD1 Monoclonal antibody specifically detects YOD1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| YOD1 | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| DKFZp451J1719, DUBA-8, DUBA8hsHIN7, EC 3.1.2, EC 3.4.19.12, HIN7, HIN-7, HIV-1-induced protease 7, HsHIN7, OTU domain-containing protein 2, OTUD2OTU domain containing 2, PRO0907, ubiquitin thioesterase OTU1, YOD1 OTU deubiquinating enzyme 1 homolog ( yeast), YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) | |
| A synthetic peptide corresponding to a sequence within amino acids 249-348 of human YOD1.3).,, Sequence:, FGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV | |
| 20 μL | |
| Cell Biology, Endocrinology, Signal Transduction | |
| 55432 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction