YL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56002-25ul

Product Code. 18642757

Beskrivning

YL1 Polyclonal specifically detects YL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

• Antigen: YL1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: Protein YL-1, Swc2, TCFL1, Transcription factor-like 1, transcription factor-like 1 (YL-1), vacuolar protein sorting 72 (yeast), vacuolar protein sorting 72 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 72 homolog, YL-1, YL1CFL1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: VPS72
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
• Quantity: 25 μL
• Research Discipline: Autophagy
• Gene ID (Entrez): 6944
• Target Species: Human
• Isotype: IgG

For Research Use Only