missing translation for 'onlineSavingsMsg'
Learn More
Learn More
YIPF5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifica
| Antigen | YIPF5 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|
18242074
|
Novus Biologicals
NBP2-57970 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661118
|
Novus Biologicals
NBP2-57970-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
YIPF5 Polyclonal specifically detects YIPF5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifica
| YIPF5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 81555 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| FinGER5, Golgi Membrane Protein SB140, Protein YIPF5, SB140, SMAP5, SMAP-5, Smooth Muscle Cell Associated Protein 5, Smooth Muscle Cell-Associated Protein 5, Yip1 Domain Family Member 5, Yip1 Domain Family, Member 5, YIP1 Family Member 5, YIP1A, YPT-Interacting Protein 1 A | |
| YIPF5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title