missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18365889

Yes Antibody (3C6), Novus Biologicals™

Product Code. 18365889 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18365889 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18365889 Supplier Novus Biologicals Supplier No. H00007525M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Yes Monoclonal antibody specifically detects Yes in Human samples. It is validated for Western Blot, ELISA, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen Yes
Applications Western Blot, ELISA, Proximity Ligation Assay
Classification Monoclonal
Clone 3C6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH48960
Gene Alias cellular yes-1 protein, c-yes, EC 2.7.10, EC 2.7.10.2, HsT441, P61-YES, Proto-oncogene c-Yes, proto-oncogene tyrosine-protein kinase Yes, v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1, Yamaguchi sarcoma oncogene, Yes
Host Species Mouse
Immunogen YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 7525
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.