YB1 Rabbit anti-Human, Mouse, Rat, Clone: 9J7M4, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16213-100UL

Product Code. 18394136

Description

YB1 Monoclonal antibody specifically detects YB1 in Human, Mouse, Rat samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)

Specifications

• Antigen: YB1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ChIP Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation
• Clone: 9J7M4
• Dilution: Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB1 (P67809). GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
• Quantity: 100 μg
• Research Discipline: Breast Cancer, Cancer, DNA Repair, Epigenetics, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Transcription Factors and Regulators, Translation Control
• Gene ID (Entrez): 4904
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG