missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
YB1 Monoclonal antibody specifically detects YB1 in Human, Mouse, Rat samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | YB1 |
| Applications | ChIP Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation |
| Classification | Monoclonal |
| Clone | 9J7M4 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB1 (P67809). GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?