missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XRRA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | XRRA1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
XRRA1 Polyclonal specifically detects XRRA1 in Human samples. It is validated for Western Blot.Specifications
| XRRA1 | |
| Polyclonal | |
| Rabbit | |
| X-ray radiation resistance associated 1 | |
| XRRA1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 143570 | |
| Synthetic peptides corresponding to XRRA1 (X-ray radiation resistance associated 1) The peptide sequence was selected from the N terminal of XRRA1)(50ug). Peptide sequence MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title