XRCC6BP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58329-25ul

Product Code. 18688877

Description

XRCC6BP1 Polyclonal specifically detects XRCC6BP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: XRCC6BP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 3.4.24, EC 3.4.24.-, Ku70-binding protein 3, KUB3Ku70 binding protein 3, MGC134817, MGC134818, mitochondrial inner membrane protease ATP23 homolog, XRCC6 binding protein 1, XRCC6-binding protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP23
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTCNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHF
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 91419
• Target Species: Human
• Isotype: IgG

For Research Use Only