XPB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18348756	Novus Biologicals NBP3-10467-100UL	100 μg

Description

XPB Polyclonal specifically detects XPB in Human samples. It is validated for Western Blot.

Specifications

• Antigen: XPB
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 2071
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XPB (NP_000113). Peptide sequence MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
• Purification Method: Affinity purified