missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Xanthine Oxidase Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09419-100UL
This item is not returnable.
View return policy
Description
Xanthine Oxidase Polyclonal specifically detects Xanthine Oxidase in Rat samples. It is validated for Western Blot.
Specifications
| Xanthine Oxidase | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Xanthine Oxidase (NP_058850). Peptide sequence EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS | |
| 100 μg | |
| Signal Transduction | |
| 7498 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction