missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Xanthine Oxidase Rabbit anti-Human, Mouse, Rat, Clone: 0M8E7, Novus Biologicals™
Rabbit Monoclonal Antibody
£167.00 - £413.00
Specifications
| Antigen | Xanthine Oxidase |
|---|---|
| Clone | 0M8E7 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18399886
|
Novus Biologicals
NBP3-16735-20UL |
20 μg |
£167.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18332866
|
Novus Biologicals
NBP3-16735-100UL |
100 μg |
£413.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Xanthine Oxidase Monoclonal antibody specifically detects Xanthine Oxidase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Xanthine Oxidase | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 0M8E7 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 7498 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title