WWOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP2-47579-25ul

Product Code. 18615935

Description

WWOX Polyclonal specifically detects WWOX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunoblotting.

Specifications

• Antigen: WWOX
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunoblotting
• Gene Alias: D16S432E, EC 1.1.1, EC 1.1.1.-, FORHHCMA56, FRA16D, Fragile site FRA16D oxidoreductase, SDR41C1, short chain dehydrogenase/reductase family 41C, member 1, WOX1PRO0128, WW domain containing oxidoreductase, WW domain-containing oxidoreductase, WW domain-containing protein WWOX
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoblot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: WWOX
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS
• Quantity: 25 μL
• Research Discipline: Alzheimers Research, Apoptosis, Cancer, Neuroscience, Tumor Suppressors
• Gene ID (Entrez): 51741
• Target Species: Human
• Isotype: IgG

For Research Use Only