WT1, Mouse anti-Human, Clone: 1E9, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00007490-M06.100ug

Product Code. 16167555

Description

Sequence: QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC

Specifications

• Antigen: WT1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: Wilms tumor 1
• Gene Alias: GUD/WAGR/WIT-2/WT33
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
• Clone: 1E9
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_000378
• Gene Symbols: WT1
• Immunogen: WT1 (NP_000369.3, 349 a.a. ∼ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 7490
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ