Learn More
Invitrogen™ WNT7A Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA580231
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human hepatocellular carcinoma tumor tissue (HCCT), human hepatocellular carcinoma paracancerous tissue (HCCP)rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. Flow: PC-3 cell.
Wnt-7a belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. It is expressed in placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain. Most Wnt proteins can signal though a mechanism called the canonical Wnt pathway, in which Wnt proteins bind to and activate seven-pass transmembrane receptors of the Frizzled family, ultimately leading to the disruption of β-catenin degradation. Intracellular accumulation of β-catenin increases translocation of the protein into the nucleus, where it binds to TCF/LEF transcription factors to induce the expression of numerous genes. Increased Wnt/β-catenin signaling is associated with tumorigenesis in a diverse set of human cancers. However, Wnt-7a/Frizzled-9 signaling has been shown to act as a tumor suppressor in non-small cell lung cancers.
Specifications
| WNT7A | |
| Polyclonal | |
| Unconjugated | |
| Wnt7a | |
| AI849442; postaxial hemimelia; protein Wnt-7a; proto-oncogene Wnt7a protein; px; tw; wingless-related MMTV integration site 7A; wingless-type MMTV integration site 7A; wingless-type MMTV integration site family member 7A; wingless-type MMTV integration site family, member 7A; Wnt family member 7A; WNT7A; Wnt-7a | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 114850, 22421, 7476 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| O00755, P24383 | |
| Wnt7a | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.