Wnt-7b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Brand:  Novus Biologicals NBP1-59564

Product Code. 18706143

Description

Wnt-7b Polyclonal specifically detects Wnt-7b in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: Wnt-7b
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: protein Wnt-7b, wingless-type MMTV integration site family, member 7B
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction, Wnt Signaling Pathway
• Gene ID (Entrez): 7477
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml, Immunohistochemistry-Frozen
• Gene Accession No.: P56706
• Gene Symbols: WNT7B
• Immunogen: Synthetic peptides corresponding to WNT7B(wingless-type MMTV integration site family, member 7B) The peptide sequence was selected from the middle region of WNT7B (NP_478679) Peptide sequence WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 78%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only