missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Wnt-10b Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Wnt-10b |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18276522
|
Novus Biologicals
NBP2-56449 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653528
|
Novus Biologicals
NBP2-56449-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
Wnt-10b Polyclonal specifically detects Wnt-10b in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| Wnt-10b | |
| Polyclonal | |
| Rabbit | |
| Wnt Signaling Pathway | |
| protein Wnt-10b, Protein Wnt-12, SHFM6WNT-10B protein, wingless-type MMTV integration site family, member 10B, WNT12, WNT-12 | |
| WNT10B | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7480 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel