missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Wnt-10b Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49165-25ul
This item is not returnable.
View return policy
Description
Wnt-10b Polyclonal antibody specifically detects Wnt-10b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Wnt-10b | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| protein Wnt-10b, Protein Wnt-12, SHFM6WNT-10B protein, wingless-type MMTV integration site family, member 10B, WNT12, WNT-12 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS | |
| 25 μL | |
| Wnt Signaling Pathway | |
| 7480 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction