missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WISP2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£154.00 - £366.00
Specifications
| Antigen | WISP2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667302
|
Novus Biologicals
NBP2-95088-0.02ml |
0.02 mL |
£154.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631102
|
Novus Biologicals
NBP2-95088-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
WISP2 Polyclonal antibody specifically detects WISP2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| WISP2 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Stem Cells | |
| PBS (pH 7.3), 50% glycerol | |
| 8839 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Connective tissue growth factor-like protein, Connective tissue growth factor-related protein 58, CT58CTGF-Lwnt-1 signaling pathway protein 2, CTGFL, WISP-2, WNT1 inducible signaling pathway protein 2, WNT1-inducible-signaling pathway protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human WISP2 (NP_003872.1). VEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title