WIPI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56873

Product Code. 18254922

Description

WIPI1 Polyclonal specifically detects WIPI1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WIPI1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Atg18, Atg18 protein homolog, ATG18A, FLJ10055, WD repeat domain phosphoinositide-interacting protein 1, WD repeat domain, phosphoinositide interacting 1, WD40 repeat protein interacting with phosphoinositides of 49 kDa, WD40 repeat protein Interacting with phosphoInositides of 49kDa, WIPI 49 kDa, WIPI-1, WIPI-1 alpha, WIPI49ATG18
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55062
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5MNZ9
• Gene Symbols: WIPI1
• Immunogen: Synthetic peptides corresponding to WIPI1(WD repeat domain, phosphoinositide interacting 1) The peptide sequence was selected from the N terminal of WIPI1. Peptide sequence AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Guinea pig: 92%; Bovine: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG